| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
| Protein Sentrin-specific protease 2, SENP2 [110771] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [110772] (7 PDB entries) Uniprot Q9HC62 366-589 |
| Domain d5aeks_: 5aek S: [313405] Other proteins in same PDB: d5aekb_, d5aekd_, d5aekf_, d5aekh_, d5aekj_, d5aekl_, d5aekn_, d5aekp_, d5aekr_, d5aekt_, d5aekv_, d5aekx_ automated match to d2io0a1 |
PDB Entry: 5aek (more details), 3 Å
SCOPe Domain Sequences for d5aeks_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aeks_ d.3.1.7 (S:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
Timeline for d5aeks_: