| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
| Protein automated matches [190233] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries) |
| Domain d5aekf_: 5aek F: [313059] Other proteins in same PDB: d5aeka_, d5aekc_, d5aeke_, d5aekg_, d5aeki_, d5aekk_, d5aekm_, d5aeko_, d5aekq_, d5aeks_, d5aeku_, d5aekw_ automated match to d2vrrb_ |
PDB Entry: 5aek (more details), 3 Å
SCOPe Domain Sequences for d5aekf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aekf_ d.15.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
lgmeeedvievyqeqtgg
Timeline for d5aekf_: