Lineage for d5aekq_ (5aek Q:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927257Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 2927278Protein Sentrin-specific protease 2, SENP2 [110771] (1 species)
  7. 2927279Species Human (Homo sapiens) [TaxId:9606] [110772] (7 PDB entries)
    Uniprot Q9HC62 366-589
  8. 2927296Domain d5aekq_: 5aek Q: [312490]
    Other proteins in same PDB: d5aekb_, d5aekd_, d5aekf_, d5aekh_, d5aekj_, d5aekl_, d5aekn_, d5aekp_, d5aekr_, d5aekt_, d5aekv_, d5aekx_
    automated match to d2io0a1

Details for d5aekq_

PDB Entry: 5aek (more details), 3 Å

PDB Description: crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
PDB Compounds: (Q:) Sentrin-specific protease 2

SCOPe Domain Sequences for d5aekq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aekq_ d.3.1.7 (Q:) Sentrin-specific protease 2, SENP2 {Human (Homo sapiens) [TaxId: 9606]}
leltedmekeisnalghgpqdeilssafklritrgdiqtlknyhwlndevinfymnllve
rnkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhwslvvid
lrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkpheipqqlng
sdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll

SCOPe Domain Coordinates for d5aekq_:

Click to download the PDB-style file with coordinates for d5aekq_.
(The format of our PDB-style files is described here.)

Timeline for d5aekq_: