SCOPe 2.06: Domain d4zfwa_: 4zfw A:

Lineage for d4zfwa_ (4zfw A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.0: automated matches [191615] (1 protein)
   not a true family

6. Protein automated matches [191124] (7 species)
   not a true protein

7. Species Momordica charantia [TaxId:3673] [312311] (9 PDB entries)

8. Domain d4zfwa_: 4zfw A: [313038]
   Other proteins in same PDB: d4zfwb1, d4zfwb2
   automated match to d1abra_
   complexed with bma, fuc, gal, gla, gol, nag, xyp

Details for d4zfwa_

PDB Entry: 4zfw, 2.54 Å

PDB Description: structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with galactose.

PDB Compounds: (A:) rRNA N-glycosidase

SCOPe Domain Sequences for d4zfwa_:

Sequence; same for both SEQRES and ATOM records:

>d4zfwa_ d.165.1.0 (A:) automated matches {Momordica charantia [TaxId: 3673]}
nlslsqsnfsadtyksfiknlrkqltigasygsagipilkhsvpicerfllvdltngdne
titlainvedagfaayraadrsyffqnappiasyviftdtnqnimnfnntfesieivggt
trsetplgimhfeasifhlfvhdenyvptsflvliqmvleaakfkfieqkvihsimdmed
ftpglamlsleenwtqlslqlqaseslngvfgdsvslynsmdepigvdsmyypiltanma
fqlyqcp

Timeline for d4zfwa_:

• d4zfwa_ is new in SCOPe 2.06-stable
  
• d4zfwa_ appears in SCOPe 2.07
  
• d4zfwa_ appears in the current release, SCOPe 2.08