| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
| Family d.165.1.0: automated matches [191615] (1 protein) not a true family |
| Protein automated matches [191124] (7 species) not a true protein |
| Species Momordica charantia [TaxId:3673] [312311] (9 PDB entries) |
| Domain d4zfwa_: 4zfw A: [313038] Other proteins in same PDB: d4zfwb1, d4zfwb2 automated match to d1abra_ complexed with bma, fuc, gal, gla, gol, nag, xyp |
PDB Entry: 4zfw (more details), 2.54 Å
SCOPe Domain Sequences for d4zfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zfwa_ d.165.1.0 (A:) automated matches {Momordica charantia [TaxId: 3673]}
nlslsqsnfsadtyksfiknlrkqltigasygsagipilkhsvpicerfllvdltngdne
titlainvedagfaayraadrsyffqnappiasyviftdtnqnimnfnntfesieivggt
trsetplgimhfeasifhlfvhdenyvptsflvliqmvleaakfkfieqkvihsimdmed
ftpglamlsleenwtqlslqlqaseslngvfgdsvslynsmdepigvdsmyypiltanma
fqlyqcp
Timeline for d4zfwa_: