Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.0: automated matches [191615] (1 protein) not a true family |
Protein automated matches [191124] (8 species) not a true protein |
Species Bitter gourd (Momordica charantia) [TaxId:3673] [312311] (16 PDB entries) |
Domain d4zfwa_: 4zfw A: [313038] Other proteins in same PDB: d4zfwb1, d4zfwb2 automated match to d1abra_ complexed with gal, gla, gol, nag |
PDB Entry: 4zfw (more details), 2.54 Å
SCOPe Domain Sequences for d4zfwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zfwa_ d.165.1.0 (A:) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]} nlslsqsnfsadtyksfiknlrkqltigasygsagipilkhsvpicerfllvdltngdne titlainvedagfaayraadrsyffqnappiasyviftdtnqnimnfnntfesieivggt trsetplgimhfeasifhlfvhdenyvptsflvliqmvleaakfkfieqkvihsimdmed ftpglamlsleenwtqlslqlqaseslngvfgdsvslynsmdepigvdsmyypiltanma fqlyqcp
Timeline for d4zfwa_: