Lineage for d6reqb2 (6req B:476-638)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.6: Cobalamin (vitamin B12)-binding domain [52242] (1 family) 
Family c.23.6.1: Cobalamin (vitamin B12)-binding domain [52243] (5 proteins) 
Protein Methylmalonyl-CoA mutase beta subunit, C-terminal domain [88719] (1 species)
inactive subunitSpecies Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [88720] (8 PDB entries) 
Domain d6reqb2: 6req B:476-638 [31252]
Other proteins in same PDB: d6reqa1, d6reqa2, d6reqb1, d6reqc1, d6reqc2, d6reqd1
complexed with 3cp, b12, gol
Details for d6reqb2
PDB Entry: 6req (more details), 2.2 Å
PDB Description: methylmalonyl-coa mutase, 3-carboxypropyl-coa inhibitor complex
PDB Compounds: (B:) protein (methylmalonyl-coa mutase)SCOPe Domain Sequences for d6reqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}
tkpfpaaparkglawhrdsevfeqlmdrstsvserpkvflaclgtrrdfggregfsspvw
hiagidtpqveggttaeiveafkksgaqvadlcssakvyaqqglevakalkaagakalyl
sgafkefgddaaeaeklidgrlfmgmdvvdtlsstldilgvak
SCOPe Domain Coordinates for d6reqb2:
Click to download the PDB-style file with coordinates for d6reqb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6reqb2:
View in 3D
