| Class b: All beta proteins [48724] (178 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
| Protein automated matches [226913] (9 species) not a true protein |
| Species Bitter gourd (Momordica charantia) [TaxId:3673] [312303] (9 PDB entries) |
| Domain d4zfwb2: 4zfw B:133-261 [312305] Other proteins in same PDB: d4zfwa_ automated match to d4hr6c2 complexed with bma, fuc, gal, gla, gol, nag, xyp |
PDB Entry: 4zfw (more details), 2.54 Å
SCOPe Domain Sequences for d4zfwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zfwb2 b.42.2.0 (B:133-261) automated matches {Bitter gourd (Momordica charantia) [TaxId: 3673]}
yvepivttiiglrhmcleatdndtnvwlescvknktkqywalysddtirvnnnrnlcvss
stdsssklivirrcdgsinqrwvftpqgtisnpgyeavmdvaqndvylkkivlssatdkg
ngqqwtvfy
Timeline for d4zfwb2: