Lineage for d4hr6c2 (4hr6 C:134-264)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401897Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2401898Protein automated matches [226913] (9 species)
    not a true protein
  7. 2402000Species Trichosanthes anguina [TaxId:50544] [226741] (3 PDB entries)
  8. 2402002Domain d4hr6c2: 4hr6 C:134-264 [222719]
    automated match to d1rzob2
    complexed with amg

Details for d4hr6c2

PDB Entry: 4hr6 (more details), 2.25 Å

PDB Description: crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips
PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d4hr6c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr6c2 b.42.2.0 (C:134-264) automated matches {Trichosanthes anguina [TaxId: 50544]}
yvqpiigsivglddmcleatdgntnmwleecvpnkreqswalysdgtirvddnrelcvta
ssstydnwkvitilncdgsnnqrwvfladgsistpgnqrlamdvarsdvdlkkiilhrph
gdlnqqwvlfy

SCOPe Domain Coordinates for d4hr6c2:

Click to download the PDB-style file with coordinates for d4hr6c2.
(The format of our PDB-style files is described here.)

Timeline for d4hr6c2: