Lineage for d2fax__ (2fax -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Clostridium beijerinckii [52226] (16 PDB entries) 
Domain d2fax__: 2fax - [31194]
Details for d2fax__
PDB Entry: 2fax (more details), 1.8 Å
PDB Description: clostridium beijerinckii flavodoxin mutant: n137a oxidized (150k)
SCOP Domain Sequences for d2fax__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fax__ c.23.5.1 (-) Flavodoxin {Clostridium beijerinckii}
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiaai
SCOP Domain Coordinates for d2fax__:
Click to download the PDB-style file with coordinates for d2fax__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fax__:
- d2fax__ appears in SCOP 1.57
- d2fax__ appears in the current release, SCOPe 2.08, called d2faxa_
View in 3D