SCOPe 2.07: Domain d4xobe1: 4xob E:1-158

Lineage for d4xobe1 (4xob E:1-158)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [269237] (14 PDB entries)

8. Domain d4xobe1: 4xob E:1-158 [311919]
   automated match to d3zl2a_
   complexed with kgm, so4

Details for d4xobe1

PDB Entry: 4xob, 3 Å

PDB Description: crystal structure of a fimh*dsf complex from e.coli k12 with bound heptyl alpha-d-mannopyrannoside

PDB Compounds: (E:) protein fimh

SCOPe Domain Sequences for d4xobe1:

Sequence; same for both SEQRES and ATOM records:

>d4xobe1 b.2.3.2 (E:1-158) automated matches {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

Timeline for d4xobe1:

• d4xobe1 first appeared in SCOPe 2.06
  
• d4xobe1 appears in the current release, SCOPe 2.08