Lineage for d1czra_ (1czr A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) 
Species Anacystis nidulans and Synechococcus, pcc 7942 [52225] (10 PDB entries) 
Domain d1czra_: 1czr A: [31187]
Details for d1czra_
PDB Entry: 1czr (more details), 1.9 Å
PDB Description: comparisons of wild type and mutant flavodoxins from anacystis nidulans. structural determinants of the redox potentials.
SCOP Domain Sequences for d1czra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czra_ c.23.5.1 (A:) Flavodoxin {Anacystis nidulans and Synechococcus, pcc 7942}
akiglfygtqtgvtqtiaesiqqefggesivdlndianadasdlnaydyliigcptwnvg
elqsdwegiyddldsvnfqgkkvayfgagnqvgysdnfqdamgileekisslgsqtvgyw
piegydfneskavrnnqfvglaidednqpdltknriktwvsqlksefgl
SCOP Domain Coordinates for d1czra_:
Click to download the PDB-style file with coordinates for d1czra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1czra_:
- d1czra_ appears in SCOP 1.57
- d1czra_ appears in the current release, SCOPe 2.08
View in 3D