SCOPe 2.08: Domain d4xfqa_: 4xfq A:

Lineage for d4xfqa_ (4xfq A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Porcine epidemic diarrhea virus [TaxId:28295] [311580] (3 PDB entries)

8. Domain d4xfqa_: 4xfq A: [311581]
   automated match to d3tloa_

Details for d4xfqa_

PDB Entry: 4xfq, 1.65 Å

PDB Description: crystal structure basis for pedv 3c like protease

PDB Compounds: (A:) PEDV main protease

SCOPe Domain Sequences for d4xfqa_:

Sequence; same for both SEQRES and ATOM records:

>d4xfqa_ b.47.1.4 (A:) automated matches {Porcine epidemic diarrhea virus [TaxId: 28295]}
aglrkmaqpsgvvekcivrvcygnmalnglwlgdtvmcprhviassttstidydyalsvl
rlhnfsissgnvflgvvgvtmrgallqikvnqnnvhtpkytyrtvrpgesfnilacydga
aagvygvnmrsnytirgsfingacgspgyninngtvefcylhqlelgsgchvgsdldgvm
yggyedqptlqvegasslftenvlaflyaalingstwwlsssriavdrfnewavhngmtt
vvntdcfsilaaktgvdvqrllasiqslhknfggkqilgytsltdefttgevirqmyg

Timeline for d4xfqa_:

• d4xfqa_ first appeared in SCOPe 2.06
  
• d4xfqa_ appears in SCOPe 2.07