Lineage for d3tloa_ (3tlo A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) 
Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (8 species)
contains an extra alpha-helical domain
Species Human coronavirus [TaxId:443239] [188597] (6 PDB entries) 
Domain d3tloa_: 3tlo A: [200833]
automated match to d3tlob_
complexed with gol, peg
has additional subdomain(s) that are not in the common domain
Details for d3tloa_
PDB Entry: 3tlo (more details), 1.6 Å
PDB Description: Crystal structure of HCoV-NL63 3C-like protease
PDB Compounds: (A:) 3C-like proteinaseSCOPe Domain Sequences for d3tloa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tloa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm
rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi
asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs
vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt
svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv
nl
SCOPe Domain Coordinates for d3tloa_:
Click to download the PDB-style file with coordinates for d3tloa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tloa_:
- d3tloa_ first appeared in SCOPe 2.03
- d3tloa_ appears in SCOPe 2.07
View in 3D
