Lineage for d2fsp__ (2fsp -)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345Superfamily c.23.1: CheY-like [52172] (5 families) 
Family c.23.1.1: CheY-related [52173] (18 proteins) 
Protein Sporulation response regulator Spo0F [52188] (1 species) Species Bacillus subtilis [TaxId:1423] [52189] (7 PDB entries) 
Domain d2fsp__: 2fsp - [31119]
Details for d2fsp__
PDB Entry: 2fsp (more details)
PDB Description: nmr solution structure of bacillus subtilis spo0f protein, minimized average structure
SCOP Domain Sequences for d2fsp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsp__ c.23.1.1 (-) Sporulation response regulator Spo0F {Bacillus subtilis}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn
SCOP Domain Coordinates for d2fsp__:
Click to download the PDB-style file with coordinates for d2fsp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fsp__:
- d2fsp__ first appeared (with stable ids) in SCOP 1.55
- d2fsp__ appears in SCOP 1.69
- d2fsp__ is called d2fspa_ in SCOP 1.73
- d2fsp__ appears in the current release, SCOPe 2.08, called d2fspa_
View in 3D