Lineage for d2fspa_ (2fsp A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691775Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 691776Species Bacillus subtilis [TaxId:1423] [52189] (8 PDB entries)
  8. 691791Domain d2fspa_: 2fsp A: [31119]

Details for d2fspa_

PDB Entry: 2fsp (more details)

PDB Description: nmr solution structure of bacillus subtilis spo0f protein, minimized average structure
PDB Compounds: (A:) stage 0 sporulation protein f

SCOP Domain Sequences for d2fspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fspa_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn

SCOP Domain Coordinates for d2fspa_:

Click to download the PDB-style file with coordinates for d2fspa_.
(The format of our PDB-style files is described here.)

Timeline for d2fspa_: