PDB entry 2fsp

View 2fsp on RCSB PDB site
Description: nmr solution structure of bacillus subtilis spo0f protein, minimized average structure
Deposited on 1997-06-06, released 1997-12-10
The last revision prior to the SCOP 1.71 freeze date was dated 1997-12-10, with a file datestamp of 1997-12-10.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d2fsp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fsp_ (-)
    mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
    dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
    lksn