Lineage for d2fsp__ (2fsp -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.1: CheY-like [52172] (3 families) 
Family c.23.1.1: CheY-related [52173] (9 proteins) 
Protein Sporulation response regulator Spo0F [52188] (1 species) Species Bacillus subtilis [TaxId:1423] [52189] (5 PDB entries) 
Domain d2fsp__: 2fsp - [31119]
Details for d2fsp__
PDB Entry: 2fsp (more details)
PDB Description: nmr solution structure of bacillus subtilis spo0f protein, minimized average structure
SCOP Domain Sequences for d2fsp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsp__ c.23.1.1 (-) Sporulation response regulator Spo0F {Bacillus subtilis}
mmnekilivddqygirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgm
dgieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylp
lksn
SCOP Domain Coordinates for d2fsp__:
Click to download the PDB-style file with coordinates for d2fsp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fsp__:
- d2fsp__ appears in SCOP 1.57
- d2fsp__ appears in the current release, SCOPe 2.08, called d2fspa_
View in 3D