Lineage for d5e6zc3 (5e6z C:623-728)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811031Species Escherichia coli [TaxId:331111] [311497] (3 PDB entries)
  8. 2811034Domain d5e6zc3: 5e6z C:623-728 [310465]
    Other proteins in same PDB: d5e6za1, d5e6za2, d5e6zb1, d5e6zb2, d5e6zc1, d5e6zc2, d5e6zd1, d5e6zd2
    automated match to d1m7xa2
    complexed with gol

Details for d5e6zc3

PDB Entry: 5e6z (more details), 1.88 Å

PDB Description: crystal structure of ecoli branching enzyme with beta cyclodextrin
PDB Compounds: (C:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e6zc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e6zc3 b.71.1.0 (C:623-728) automated matches {Escherichia coli [TaxId: 331111]}
pygfewlvvddkersvlifvrrdkegneiivasnftpvprhdyrfginqpgkwreilntd
smhyhgsnagnggtvhsdeiashgrqhslsltlpplatiwlvreae

SCOPe Domain Coordinates for d5e6zc3:

Click to download the PDB-style file with coordinates for d5e6zc3.
(The format of our PDB-style files is described here.)

Timeline for d5e6zc3: