Lineage for d5e6za1 (5e6z A:117-226)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766258Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries)
  8. 2766259Domain d5e6za1: 5e6z A:117-226 [310457]
    Other proteins in same PDB: d5e6za2, d5e6za3, d5e6zb2, d5e6zb3, d5e6zc2, d5e6zc3, d5e6zd2, d5e6zd3
    automated match to d1m7xa1
    complexed with gol

Details for d5e6za1

PDB Entry: 5e6z (more details), 1.88 Å

PDB Description: crystal structure of ecoli branching enzyme with beta cyclodextrin
PDB Compounds: (A:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e6za1 b.1.18.0 (A:117-226) automated matches {Escherichia coli [TaxId: 331111]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

SCOPe Domain Coordinates for d5e6za1:

Click to download the PDB-style file with coordinates for d5e6za1.
(The format of our PDB-style files is described here.)

Timeline for d5e6za1: