Lineage for d5e6zc2 (5e6z C:227-622)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081989Protein automated matches [190099] (25 species)
    not a true protein
  7. 2082019Species Escherichia coli [TaxId:331111] [311496] (3 PDB entries)
  8. 2082022Domain d5e6zc2: 5e6z C:227-622 [310464]
    Other proteins in same PDB: d5e6za1, d5e6za3, d5e6zb1, d5e6zb3, d5e6zc1, d5e6zc3, d5e6zd1, d5e6zd3
    automated match to d1m7xa3
    complexed with bcd, gol

Details for d5e6zc2

PDB Entry: 5e6z (more details), 1.88 Å

PDB Description: crystal structure of ecoli branching enzyme with beta cyclodextrin
PDB Compounds: (C:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e6zc2:

Sequence, based on SEQRES records: (download)

>d5e6zc2 c.1.8.1 (C:227-622) automated matches {Escherichia coli [TaxId: 331111]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehsdpregyhqdwntliynygrrevsnflvgnalywierfgidalrvda
vasmiyrdysrkegewipnefggrenleaieflrntnrilgeqvsgavtmaeestdfpgv
srpqdmgglgfwykwnlgwmhdtldymkldpvyrqyhhdkltfgilynytenfvlplshd
evvhgkksildrmpgdawqkfanlrayygwmwafpgkkllfmgnefaqgrewnhdasldw
hlleggdnwhhgvqrlvrdlnltyrhhkamheldfd

Sequence, based on observed residues (ATOM records): (download)

>d5e6zc2 c.1.8.1 (C:227-622) automated matches {Escherichia coli [TaxId: 331111]}
vvqteerkkanqfdapisiyevhlgswrrhtdnnfwlsyreladqlvpyakwmgfthlel
lpinehpfdgswgyqptglyaptrrfgtrddfryfidaahaaglnvildwvpghfptddf
alaefdgtnlyehsliynygrrevsnflvgnalywierfgidalrvdavasmiyrenlea
ieflrntnrilgeqvsgavtmaeestdfpgvsrpqdmgglgfwykwnlgwmhdtldymkl
dpvyrqyhhdkltfgilynytenfvlplshdevvhgkksildrmpgdawqkfanlrayyg
wmwafpgkkllfmgnefaqgrewnhdasldwhlleggdnwhhgvqrlvrdlnltyrhhka
mheldfd

SCOPe Domain Coordinates for d5e6zc2:

Click to download the PDB-style file with coordinates for d5e6zc2.
(The format of our PDB-style files is described here.)

Timeline for d5e6zc2:

  • d5e6zc2 is new in SCOPe 2.06-stable