Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries) |
Domain d5e6za1: 5e6z A:117-226 [310457] Other proteins in same PDB: d5e6za2, d5e6za3, d5e6zb2, d5e6zb3, d5e6zc2, d5e6zc3, d5e6zd2, d5e6zd3 automated match to d1m7xa1 complexed with bcd, gol |
PDB Entry: 5e6z (more details), 1.88 Å
SCOPe Domain Sequences for d5e6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e6za1 b.1.18.0 (A:117-226) automated matches {Escherichia coli [TaxId: 331111]} thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek
Timeline for d5e6za1: