SCOP 1.73: Domain d1flza_: 1flz A:

Lineage for d1flza_ (1flz A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d1flza_: 1flz A: [31027]
   complexed with ura; mutant

Details for d1flza_

PDB Entry: 1flz, 2.3 Å

PDB Description: uracil dna glycosylase with uaap

PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d1flza_:

Sequence; same for both SEQRES and ATOM records:

>d1flza_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

Timeline for d1flza_:

• d1flza_ first appeared (with stable ids) in SCOP 1.55
  
• d1flza_ appears in SCOP 1.71
  
• d1flza_ appears in SCOP 1.75
  
• d1flza_ appears in the current release, SCOPe 2.08