Lineage for d1flza_ (1flz A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily) Superfamily c.18.1: DNA glycosylase [52141] (2 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (3 species) Species Escherichia coli [TaxId:562] [52146] (9 PDB entries) 
Domain d1flza_: 1flz A: [31027]
Details for d1flza_
PDB Entry: 1flz (more details), 2.3 Å
PDB Description: uracil dna glycosylase with uaap
SCOP Domain Sequences for d1flza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flza_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
aneltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese
SCOP Domain Coordinates for d1flza_:
Click to download the PDB-style file with coordinates for d1flza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1flza_:
- d1flza_ appears in SCOP 1.57
- d1flza_ appears in the current release, SCOPe 2.08
View in 3D