![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
![]() | Protein Uracil-DNA glycosylase [52143] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [52146] (12 PDB entries) |
![]() | Domain d1flza_: 1flz A: [31027] complexed with ura |
PDB Entry: 1flz (more details), 2.3 Å
SCOPe Domain Sequences for d1flza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flza_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]} aneltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh vlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese
Timeline for d1flza_: