Lineage for d1flza_ (1flz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855022Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2855023Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2855038Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 2855050Domain d1flza_: 1flz A: [31027]
    complexed with ura

Details for d1flza_

PDB Entry: 1flz (more details), 2.3 Å

PDB Description: uracil dna glycosylase with uaap
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1flza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flza_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
aneltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvil
gqdpyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvll
lntvltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhh
vlkaphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

SCOPe Domain Coordinates for d1flza_:

Click to download the PDB-style file with coordinates for d1flza_.
(The format of our PDB-style files is described here.)

Timeline for d1flza_: