SCOPe 2.07: Domain d5avvb1: 5avv B:25-68

Lineage for d5avvb1 (5avv B:25-68)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.42: Sodium/potassium-transporting ATPase, beta subunit transmembrane helix [310574] (2 families)

5. Family f.23.42.1: Sodium/potassium-transporting ATPase, beta subunit transmembrane helix [310612] (1 protein)

6. Protein Sodium/potassium-transporting ATPase, beta subunit transmembrane helix [310695] (2 species)

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [310917] (14 PDB entries)

8. Domain d5avvb1: 5avv B:25-68 [310246]
   Other proteins in same PDB: d5avva1, d5avva2, d5avva3, d5avva4, d5avvb2, d5avvg_
   automated match to d2zxeb1
   complexed with clr, k, mf4, mg, nag, tl

Details for d5avvb1

PDB Entry: 5avv, 2.9 Å

PDB Description: kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min

PDB Compounds: (B:) Na+,K+-ATPase beta subunit

SCOPe Domain Sequences for d5avvb1:

Sequence; same for both SEQRES and ATOM records:

>d5avvb1 f.23.42.1 (B:25-68) Sodium/potassium-transporting ATPase, beta subunit transmembrane helix {Dogfish (Squalus acanthias) [TaxId: 7797]}
flgrtgsswfkiflfylifygclagifigtiqvllltlsdfepk

Timeline for d5avvb1:

• d5avvb1 first appeared in SCOPe 2.06
  
• d5avvb1 appears in the current release, SCOPe 2.08