Lineage for d5avva4 (5avv A:386-593)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613347Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 2613348Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 2613349Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 2613417Protein Sodium/potassium-transporting ATPase alpha chain [90068] (3 species)
  7. 2613418Species Dogfish (Squalus acanthias) [TaxId:7797] [310909] (15 PDB entries)
  8. 2613430Domain d5avva4: 5avv A:386-593 [310245]
    Other proteins in same PDB: d5avva1, d5avva2, d5avva3, d5avvb1, d5avvb2, d5avvg_
    automated match to d2zxea1
    complexed with clr, k, mf4, mg, nag, tl

Details for d5avva4

PDB Entry: 5avv (more details), 2.9 Å

PDB Description: kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d5avva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avva4 d.220.1.1 (A:386-593) Sodium/potassium-transporting ATPase alpha chain {Dogfish (Squalus acanthias) [TaxId: 7797]}
mtvahmwfdnqiheadttenqsgaafdktsatwsalsriaalcnravfqagqdnvpilkr
svagdasesallkcielccgsvqgmrdrnpkiveipfnstnkyqlsihenekssesryll
vmkgaperildrcstillngaeeplkedmkeafqnaylelgglgervlgfchfalpedky
negypfdadepnfpttdlcfvglmamid

SCOPe Domain Coordinates for d5avva4:

Click to download the PDB-style file with coordinates for d5avva4.
(The format of our PDB-style files is described here.)

Timeline for d5avva4: