Lineage for d5avva2 (5avv A:167-274)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2426671Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2426672Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2426728Protein Sodium/potassium-transporting ATPase, actuator domain A [310693] (2 species)
  7. 2426729Species Dogfish (Squalus acanthias) [TaxId:7797] [310913] (15 PDB entries)
  8. 2426741Domain d5avva2: 5avv A:167-274 [310243]
    Other proteins in same PDB: d5avva1, d5avva3, d5avva4, d5avvb1, d5avvb2, d5avvg_
    automated match to d2zxea3
    complexed with clr, k, mf4, mg, nag, tl

Details for d5avva2

PDB Entry: 5avv (more details), 2.9 Å

PDB Description: kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 8.5 min
PDB Compounds: (A:) Na, K-ATPase alpha subunit

SCOPe Domain Sequences for d5avva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5avva2 b.82.7.1 (A:167-274) Sodium/potassium-transporting ATPase, actuator domain A {Dogfish (Squalus acanthias) [TaxId: 7797]}
qqalvirdgekstinaefvvagdlvevkggdripadlriisahgckvdnssltgesepqt
rspefssenpletrniaffstncvegtargvvvytgdrtvmgriatla

SCOPe Domain Coordinates for d5avva2:

Click to download the PDB-style file with coordinates for d5avva2.
(The format of our PDB-style files is described here.)

Timeline for d5avva2: