SCOP 1.73: Domain d1udha_: 1udh A:

Lineage for d1udha_ (1udh A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)

8. Domain d1udha_: 1udh A: [31015]
   complexed with so4, ura

Details for d1udha_

PDB Entry: 1udh, 1.75 Å

PDB Description: the structural basis of specific base excision repair by uracil-dna glycosylase

PDB Compounds: (A:) uracil-DNA glycosylase

SCOP Domain Sequences for d1udha_:

Sequence; same for both SEQRES and ATOM records:

>d1udha_ c.18.1.1 (A:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d1udha_:

• d1udha_ first appeared (with stable ids) in SCOP 1.55, called d1udh__
  
• d1udha_ was called d1udh__ in SCOP 1.71
  
• d1udha_ appears in SCOP 1.75
  
• d1udha_ appears in the current release, SCOPe 2.08