Lineage for d1udh__ (1udh -)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578428Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 578429Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 578430Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 578431Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 578458Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)
  8. 578460Domain d1udh__: 1udh - [31015]
    complexed with so4, ura

Details for d1udh__

PDB Entry: 1udh (more details), 1.75 Å

PDB Description: the structural basis of specific base excision repair by uracil-dna glycosylase

SCOP Domain Sequences for d1udh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udh__ c.18.1.1 (-) Uracil-DNA glycosylase {Herpes simplex virus type 1}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOP Domain Coordinates for d1udh__:

Click to download the PDB-style file with coordinates for d1udh__.
(The format of our PDB-style files is described here.)

Timeline for d1udh__: