![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: DNA glycosylase [52141] (3 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
![]() | Protein Uracil-DNA glycosylase [52143] (4 species) |
![]() | Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) |
![]() | Domain d1udh__: 1udh - [31015] complexed with so4, ura |
PDB Entry: 1udh (more details), 1.75 Å
SCOP Domain Sequences for d1udh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udh__ c.18.1.1 (-) Uracil-DNA glycosylase {Herpes simplex virus type 1} ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d1udh__: