Lineage for d1udh__ (1udh -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily) Superfamily c.18.1: DNA glycosylase [52141] (2 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (3 species) 
Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) 
Domain d1udh__: 1udh - [31015]
Details for d1udh__
PDB Entry: 1udh (more details), 1.75 Å
PDB Description: the structural basis of specific base excision repair by uracil-dna glycosylase
SCOP Domain Sequences for d1udh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udh__ c.18.1.1 (-) Uracil-DNA glycosylase {Herpes simplex virus type 1}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
SCOP Domain Coordinates for d1udh__:
Click to download the PDB-style file with coordinates for d1udh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1udh__:
- d1udh__ appears in SCOP 1.57
- d1udh__ appears in the current release, SCOPe 2.08, called d1udha_
View in 3D