Lineage for d1laue_ (1lau E:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120142Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 120143Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 120144Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 120145Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 120159Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)
  8. 120160Domain d1laue_: 1lau E: [31014]

Details for d1laue_

PDB Entry: 1lau (more details), 1.8 Å

PDB Description: uracil-dna glycosylase

SCOP Domain Sequences for d1laue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOP Domain Coordinates for d1laue_:

Click to download the PDB-style file with coordinates for d1laue_.
(The format of our PDB-style files is described here.)

Timeline for d1laue_: