Lineage for d1laue_ (1lau E:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily) Superfamily c.18.1: DNA glycosylase [52141] (2 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (3 species) 
Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) 
Domain d1laue_: 1lau E: [31014]
Details for d1laue_
PDB Entry: 1lau (more details), 1.8 Å
PDB Description: uracil-dna glycosylase
SCOP Domain Sequences for d1laue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
SCOP Domain Coordinates for d1laue_:
Click to download the PDB-style file with coordinates for d1laue_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1laue_:
- d1laue_ appears in SCOP 1.57
- d1laue_ appears in the current release, SCOPe 2.08
View in 3D