![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.18: DNA glycosylase [52140] (1 superfamily) |
![]() | Superfamily c.18.1: DNA glycosylase [52141] (2 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
![]() | Protein Uracil-DNA glycosylase [52143] (3 species) |
![]() | Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) |
![]() | Domain d1laue_: 1lau E: [31014] |
PDB Entry: 1lau (more details), 1.8 Å
SCOP Domain Sequences for d1laue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1laue_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1} ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d1laue_: