Lineage for d4wlub2 (4wlu B:169-337)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999256Protein automated matches [226882] (10 species)
    not a true protein
  7. 2999283Species Human (Homo sapiens) [TaxId:9606] [225057] (9 PDB entries)
  8. 2999297Domain d4wlub2: 4wlu B:169-337 [309892]
    Other proteins in same PDB: d4wlua1, d4wlub1, d4wluc1, d4wlud1
    automated match to d2dfda2
    complexed with lmr, nad

Details for d4wlub2

PDB Entry: 4wlu (more details), 2.14 Å

PDB Description: crystal structure of l-malate and nad bound mdh2
PDB Compounds: (B:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wlub2 d.162.1.1 (B:169-337) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vttldivrantfvaelkgldparvnvpvigghagktiiplisqctpkvdfpqdqltaltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetectyf
stplllgkkgieknlgigkvssfeekmisdaipelkasikkgedfvktl

SCOPe Domain Coordinates for d4wlub2:

Click to download the PDB-style file with coordinates for d4wlub2.
(The format of our PDB-style files is described here.)

Timeline for d4wlub2: