SCOPe 2.08: Domain d4wlub1: 4wlu B:24-168

Lineage for d4wlub1 (4wlu B:24-168)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries)

8. Domain d4wlub1: 4wlu B:24-168 [309891]
   Other proteins in same PDB: d4wlua2, d4wlub2, d4wluc2, d4wlud2
   automated match to d2dfda1
   complexed with lmr, nad

Details for d4wlub1

PDB Entry: 4wlu, 2.14 Å

PDB Description: crystal structure of l-malate and nad bound mdh2

PDB Compounds: (B:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlub1:

Sequence; same for both SEQRES and ATOM records:

>d4wlub1 c.2.1.5 (B:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

Timeline for d4wlub1:

• d4wlub1 first appeared in SCOPe 2.06
  
• d4wlub1 appears in SCOPe 2.07