Lineage for d4wlub1 (4wlu B:24-168)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844882Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries)
  8. 2844892Domain d4wlub1: 4wlu B:24-168 [309891]
    Other proteins in same PDB: d4wlua2, d4wlub2, d4wluc2, d4wlud2
    automated match to d2dfda1
    complexed with lmr, nad

Details for d4wlub1

PDB Entry: 4wlu (more details), 2.14 Å

PDB Description: crystal structure of l-malate and nad bound mdh2
PDB Compounds: (B:) Malate dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4wlub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wlub1 c.2.1.5 (B:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg

SCOPe Domain Coordinates for d4wlub1:

Click to download the PDB-style file with coordinates for d4wlub1.
(The format of our PDB-style files is described here.)

Timeline for d4wlub1: