| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein automated matches [226881] (8 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225056] (8 PDB entries) |
| Domain d4wlua1: 4wlu A:24-168 [309889] Other proteins in same PDB: d4wlua2, d4wlub2, d4wluc2, d4wlud2 automated match to d2dfda1 complexed with lmr, nad |
PDB Entry: 4wlu (more details), 2.14 Å
SCOPe Domain Sequences for d4wlua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wlua1 c.2.1.5 (A:24-168) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nakvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietkaavkgylgp
eqlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpeamicvianp
vnstipitaevfkkhgvynpnkifg
Timeline for d4wlua1: