| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries) |
| Domain d4ubtb1: 4ubt B:1-268 [309707] Other proteins in same PDB: d4ubta3, d4ubtb3 automated match to d4wysa1 complexed with 3g6, cl, coa, gol, na, peg |
PDB Entry: 4ubt (more details), 1.7 Å
SCOPe Domain Sequences for d4ubtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ubtb1 c.95.1.0 (B:1-268) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
tqfgeqsnnisrvawltaglpehvgattvdcqsgsgqqanhliagliaagaidvgiacgi
eamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrra
qrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggih
tagtssqisdgaaavlwmdeavarahgl
Timeline for d4ubtb1: