Lineage for d4ubtd2 (4ubt D:269-391)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917965Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)
  8. 2917977Domain d4ubtd2: 4ubt D:269-391 [309713]
    Other proteins in same PDB: d4ubta3, d4ubtb3
    automated match to d4wysa2
    complexed with 3g6, cl, coa, gol, na, peg

Details for d4ubtd2

PDB Entry: 4ubt (more details), 1.7 Å

PDB Description: structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis in complex with a steroid and coa.
PDB Compounds: (D:) Acetyl-CoA acetyltransferase FadA5

SCOPe Domain Sequences for d4ubtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubtd2 c.95.1.0 (D:269-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswarv
hepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgtii
eri

SCOPe Domain Coordinates for d4ubtd2:

Click to download the PDB-style file with coordinates for d4ubtd2.
(The format of our PDB-style files is described here.)

Timeline for d4ubtd2: