![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [277961] (5 PDB entries) |
![]() | Domain d4wysa1: 4wys A:-2-270 [277962] automated match to d3ss6a1 |
PDB Entry: 4wys (more details), 2.1 Å
SCOPe Domain Sequences for d4wysa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wysa1 c.95.1.0 (A:-2-270) automated matches {Escherichia coli [TaxId: 83333]} mgamkncvivsavrtaigsfngslastsaidlgatvikaaierakidsqhvdevimgnvl qaglgqnparqallksglaetvcgftvnkvcgsglksvalaaqaiqagqaqsivaggmen mslapylldakarsgyrlgdgqvydvilrdglmcathgyhmgitaenvakeygitremqd elalhsqrkaaaaiesgaftaeivpvnvvtrkktfvfsqdefpkanstaealgalrpafd kagtvtagnasgindgaaalvimeesaalaagl
Timeline for d4wysa1: