SCOPe 2.08: Domain d4ubtc2: 4ubt C:269-391

Lineage for d4ubtc2 (4ubt C:269-391)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [228163] (23 PDB entries)

8. Domain d4ubtc2: 4ubt C:269-391 [309711]
   Other proteins in same PDB: d4ubta3, d4ubtb3
   automated match to d4wysa2
   complexed with 3g6, cl, coa, gol, na, peg

Details for d4ubtc2

PDB Entry: 4ubt, 1.7 Å

PDB Description: structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. tuberculosis in complex with a steroid and coa.

PDB Compounds: (C:) Acetyl-CoA acetyltransferase FadA5

SCOPe Domain Sequences for d4ubtc2:

Sequence; same for both SEQRES and ATOM records:

>d4ubtc2 c.95.1.0 (C:269-391) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tprarivaqalvgaepyyhldgpvqstakvlekagmkigdidiveineafasvvlswarv
hepdmdrvnvnggaialghpvgctgsrlittalhelertdqslalitmcaggalstgtii
eri

Timeline for d4ubtc2:

• d4ubtc2 first appeared in SCOPe 2.06
  
• d4ubtc2 appears in SCOPe 2.07