Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qzxb_: 4qzx B: [309278] Other proteins in same PDB: d4qzxa_, d4qzxc_, d4qzxd_, d4qzxe_, d4qzxg_, d4qzxi_, d4qzxj_, d4qzxk_, d4qzxl_, d4qzxn_, d4qzxo_, d4qzxq_, d4qzxr_, d4qzxs_, d4qzxu_, d4qzxw_, d4qzxx_, d4qzxy_, d4qzxz_ automated match to d1rypc_ complexed with 04c, cl, mes, mg; mutant |
PDB Entry: 4qzx (more details), 2.6 Å
SCOPe Domain Sequences for d4qzxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qzxb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qzxb_: