SCOPe 2.07: Domain d4qzxt_: 4qzx T:

Lineage for d4qzxt_ (4qzx T:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qzxt_: 4qzx T: [309294]
   Other proteins in same PDB: d4qzxa_, d4qzxc_, d4qzxd_, d4qzxe_, d4qzxg_, d4qzxi_, d4qzxj_, d4qzxk_, d4qzxl_, d4qzxn_, d4qzxo_, d4qzxq_, d4qzxr_, d4qzxs_, d4qzxu_, d4qzxw_, d4qzxx_, d4qzxy_, d4qzxz_
   automated match to d4g4sg_
   complexed with 04c, cl, mes, mg; mutant

Details for d4qzxt_

PDB Entry: 4qzx, 2.6 Å

PDB Description: yCP beta5-C63F mutant in complex with the epoxyketone inhibitor ONX 0914

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qzxt_:

Sequence; same for both SEQRES and ATOM records:

>d4qzxt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4qzxt_:

• d4qzxt_ first appeared in SCOPe 2.06
  
• d4qzxt_ appears in the current release, SCOPe 2.08