Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d4qv9b_: 4qv9 B: [308402] Other proteins in same PDB: d4qv9a_, d4qv9c_, d4qv9d_, d4qv9e_, d4qv9g_, d4qv9i_, d4qv9j_, d4qv9k_, d4qv9l_, d4qv9n_, d4qv9o_, d4qv9q_, d4qv9r_, d4qv9s_, d4qv9u_, d4qv9w_, d4qv9x_, d4qv9y_, d4qv9z_ automated match to d1rypc_ complexed with cl, mg; mutant |
PDB Entry: 4qv9 (more details), 2.6 Å
SCOPe Domain Sequences for d4qv9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv9b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d4qv9b_: