Lineage for d4qv9t_ (4qv9 T:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2599925Domain d4qv9t_: 4qv9 T: [308418]
    Other proteins in same PDB: d4qv9a_, d4qv9c_, d4qv9d_, d4qv9e_, d4qv9g_, d4qv9i_, d4qv9j_, d4qv9k_, d4qv9l_, d4qv9n_, d4qv9o_, d4qv9q_, d4qv9r_, d4qv9s_, d4qv9u_, d4qv9w_, d4qv9x_, d4qv9y_, d4qv9z_
    automated match to d4g4sg_
    complexed with cl, mg; mutant

Details for d4qv9t_

PDB Entry: 4qv9 (more details), 2.6 Å

PDB Description: yCP beta5-C63F mutant
PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qv9t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv9t_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4qv9t_:

Click to download the PDB-style file with coordinates for d4qv9t_.
(The format of our PDB-style files is described here.)

Timeline for d4qv9t_: