Lineage for d1ay7b_ (1ay7 B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.9: Barstar-like [52037] (2 superfamilies) Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) 
Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein) Protein Barstar (barnase inhibitor) [52040] (1 species) Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries) 
Domain d1ay7b_: 1ay7 B: [30836]
Other proteins in same PDB: d1ay7a_
Details for d1ay7b_
PDB Entry: 1ay7 (more details), 1.7 Å
PDB Description: ribonuclease sa complex with barstar
SCOP Domain Sequences for d1ay7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ay7b_ c.9.1.1 (B:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils
SCOP Domain Coordinates for d1ay7b_:
Click to download the PDB-style file with coordinates for d1ay7b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ay7b_:
- d1ay7b_ appears in SCOP 1.57
- d1ay7b_ appears in the current release, SCOPe 2.08
View in 3D
