Lineage for d1e0rb_ (1e0r B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) Superfamily c.8.5: GroEL-like chaperone, apical domain [52029] (2 families) 
Family c.8.5.2: Group II chaperonin (CCT, TRIC) [52034] (1 protein) Protein Thermosome [52035] (1 species) Species Thermoplasma acidophilum [TaxId:2303] [52036] (5 PDB entries) 
Domain d1e0rb_: 1e0r B: [30824]
Details for d1e0rb_
PDB Entry: 1e0r (more details), 2.8 Å
PDB Description: beta-apical domain of thermosome
SCOP Domain Sequences for d1e0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0rb_ c.8.5.2 (B:) Thermosome {Thermoplasma acidophilum}
mngiivdkekvhpgmpdvvkdakialldapleikkpefdtnlriedpsmiqkflaqeenm
lremvdkiksvganvvitqkgiddmaqhylsragiyavrrvkksdmdklakatgasivst
ideisssdlgtaerveqvkvgedymtfvtgsknh
SCOP Domain Coordinates for d1e0rb_:
Click to download the PDB-style file with coordinates for d1e0rb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0rb_:
- d1e0rb_ appears in SCOP 1.57
- d1e0rb_ appears in the current release, SCOPe 2.08
View in 3D