SCOPe 2.08: Domain d4qv0q1: 4qv0 Q:1-234

Lineage for d4qv0q1 (4qv0 Q:1-234)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d4qv0q1: 4qv0 Q:1-234 [308224]
   Other proteins in same PDB: d4qv0a_, d4qv0b_, d4qv0c2, d4qv0d_, d4qv0e_, d4qv0f_, d4qv0g_, d4qv0h_, d4qv0i_, d4qv0j_, d4qv0k_, d4qv0l_, d4qv0m_, d4qv0n_, d4qv0o_, d4qv0p_, d4qv0q2, d4qv0r_, d4qv0s_, d4qv0t_, d4qv0u_, d4qv0v_, d4qv0w_, d4qv0x_, d4qv0y_, d4qv0z_
   automated match to d4eu2a_
   complexed with cl, mg; mutant

Details for d4qv0q1

PDB Entry: 4qv0, 3.1 Å

PDB Description: ycp beta5-a49t-a50v-double mutant

PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qv0q1:

Sequence; same for both SEQRES and ATOM records:

>d4qv0q1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

Timeline for d4qv0q1:

• d4qv0q1 first appeared in SCOPe 2.06, called d4qv0q_
  
• d4qv0q1 was called d4qv0q_ in SCOPe 2.07