Lineage for d4qv0q_ (4qv0 Q:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2230570Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2230571Protein automated matches [190509] (14 species)
    not a true protein
  7. 2230621Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (91 PDB entries)
  8. 2230703Domain d4qv0q_: 4qv0 Q: [308224]
    Other proteins in same PDB: d4qv0a_, d4qv0b_, d4qv0e_, d4qv0f_, d4qv0g_, d4qv0h_, d4qv0i_, d4qv0j_, d4qv0k_, d4qv0l_, d4qv0m_, d4qv0n_, d4qv0o_, d4qv0p_, d4qv0s_, d4qv0t_, d4qv0u_, d4qv0v_, d4qv0w_, d4qv0x_, d4qv0y_, d4qv0z_
    automated match to d4eu2a_
    complexed with cl, mg; mutant

Details for d4qv0q_

PDB Entry: 4qv0 (more details), 3.1 Å

PDB Description: ycp beta5-a49t-a50v-double mutant
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4qv0q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qv0q_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4qv0q_:

Click to download the PDB-style file with coordinates for d4qv0q_.
(The format of our PDB-style files is described here.)

Timeline for d4qv0q_: