Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4qv0u_: 4qv0 U: [308227] Other proteins in same PDB: d4qv0a_, d4qv0c1, d4qv0c2, d4qv0e_, d4qv0i_, d4qv0j_, d4qv0k_, d4qv0l_, d4qv0n_, d4qv0o_, d4qv0q1, d4qv0q2, d4qv0s_, d4qv0w_, d4qv0x_, d4qv0y_, d4qv0z_ automated match to d1rypa_ complexed with cl, mg; mutant |
PDB Entry: 4qv0 (more details), 3.1 Å
SCOPe Domain Sequences for d4qv0u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qv0u_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae q
Timeline for d4qv0u_:
View in 3D Domains from other chains: (mouse over for more information) d4qv0a_, d4qv0b_, d4qv0c1, d4qv0c2, d4qv0d_, d4qv0e_, d4qv0f_, d4qv0g_, d4qv0h_, d4qv0i_, d4qv0j_, d4qv0k_, d4qv0l_, d4qv0m_, d4qv0n_, d4qv0o_, d4qv0p_, d4qv0q1, d4qv0q2, d4qv0r_, d4qv0s_, d4qv0t_, d4qv0v_, d4qv0w_, d4qv0x_, d4qv0y_, d4qv0z_ |