SCOPe 2.08: Domain d4qsqa1: 4qsq A:981-1108

Lineage for d4qsqa1 (4qsq A:981-1108)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d4qsqa1: 4qsq A:981-1108 [308147]
   Other proteins in same PDB: d4qsqa2
   automated match to d4tz2a_
   complexed with dms, edo, so4

Details for d4qsqa1

PDB Entry: 4qsq, 1.8 Å

PDB Description: Structure of the bromodomain of human ATPase family AAA domain-containing protein 2 (ATAD2) with bound DMSO

PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4qsqa1:

Sequence; same for both SEQRES and ATOM records:

>d4qsqa1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

Timeline for d4qsqa1:

• d4qsqa1 first appeared in SCOPe 2.06
  
• d4qsqa1 appears in SCOPe 2.07